SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256425569|ref|YP_003126222.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256425569|ref|YP_003126222.1|
Domain Number 1 Region: 123-276
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 8.64e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00063
Further Details:      
 
Domain Number 2 Region: 399-563
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.79e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 20-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.37e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.0088
Further Details:      
 
Domain Number 4 Region: 258-281,311-413
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0000000000000294
Family Duplicated SiR/NiR-like domains 1 and 3 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256425569|ref|YP_003126222.1|
Sequence length 704
Comment sulfite reductase [Chitinophaga pinensis DSM 2588]
Sequence
MQSFRTELENPVVERDIIELEKKIRLFREGQIPEEKFRSLRLARGIYGQRQPGVQMIRIK
LPYGKMTLEQWKRISDVSDEFSTGNLHLTTRQDVQIHFVSLDRTPELWSKLDLDDITIRE
ACGNTVRNITASDRAGIDPQEPFDVTPYADATFRYFLRNPICQDMGRKIKMSFSSSDADT
AWSFMHDMGAIPKVRIVNGEEVRGFKVLVGGGLGAQPYLAHVAHEFLEADQLIPYIESVL
RVFDRHGERASRHKARMKFLVQKLGFEEFSRLVAEERIANKVKSYPIDAEAWPDVELPAA
DVTLPAYTIKDAQKYEAWKATNAFRQRQADYYAAYVRVPLGNISSVISRQLVEALRPAVA
NDVRVTANQGLLLKYIQPAHLPYVFSVLETAGFAEPGFDSIADITACPGTDTCNLAISSS
TGISTALELVIAEEFPDLVYNKDIKIKISGCMNSCGQHGIASIGFHGSSLKSGGKVLPAL
QVLLGGGIVGDGVGRVADKVIKVPSKRGPDVLRTLLRDYEANAQQHEKFNEYYDRQGEKY
FYDLLKPLTDLGTLEDEDFVDWGQGDKFATAIGVGECASVVIDLVATLLFEGEEKLQSGK
IALDEKQYADGIYHSYSTFVQTAKALLLGEGVSCNTQTGIINDFDKHFVETGKWPLDGSF
KTLVLQINQNEPSESFAKEYYQQAADFYQQAHAFRNQAAAVTAQ
Download sequence
Identical sequences C7PMB6
gi|256425569|ref|YP_003126222.1| WP_012794184.1.2976 485918.Cpin_6617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]