SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256425922|ref|YP_003126575.1| from Chitinophaga pinensis DSM 2588

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256425922|ref|YP_003126575.1|
Domain Number 1 Region: 226-580
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.25e-74
Family beta-Lactamase/D-ala carboxypeptidase 0.00045
Further Details:      
 
Domain Number 2 Region: 49-236
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 9.94e-19
Family Penicillin binding protein dimerisation domain 0.012
Further Details:      
 
Domain Number 3 Region: 647-698
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256425922|ref|YP_003126575.1|
Sequence length 701
Comment peptidoglycan glycosyltransferase [Chitinophaga pinensis DSM 2588]
Sequence
MEVKKDILWRVYLCFIGMGLFGVAILVKIFLVQNIEGNYWRSMADSLHTRYVSLEADRGT
IYSEEGRMLSTSIPYFNLRVDFAADGLREKNGKRFTDNVDSLALCLSQLFKDHTQKEYKN
ILREGYQRKDRYFLLKRDVLFVQYQAVRNFPMFRLGKNKGGLIAETKNKRINPFKLLANR
TIGLSRENAQNVGLERTYDNFLKGVTGKRLMRRIAGGTFVPVEGYDIEPENGRDIITTID
VNMQDIAETALMNMMVSNEAQHGTCILMEVKTGKIKAIANLGRQPDGSYWEDMNYALQVG
EPGSTFKLATVIAALDDQYVSMNDQVNLNEGRLQIGKRTVFDSEPHPGQTNVSIKHAFEL
SSNVGMAQLAMRCYAKKPNEFVAHLRKLNLDKATGIDLVGEGKPVIKSTKSKTWSATSLP
WMSFGYEVLVSPLQTCMLYNAVANNGKMMKPYLVNSIMEYGQPVKDYDPEVVMDSICSQN
TLRQVKAMLEGVVTNGTGRALWTPYYKLAGKTGTALVANGKDGYKEKIYQSSFAGYFPAN
DPQFTCVVVIKNKANAVKFYGGAVAGPVFREVADKLYAIALEKQRPMRAAVAIDTLLAFK
TGQGREWKTILNTLDLPMQGAVGNSNWVSPRVNGKKITFAAVKQAKGGVPDVTGMGLKDA
LYLLENAGMRVIVRGAGKVTNQSIPGGSLLERNQTIVIELS
Download sequence
Identical sequences C7PRD5
485918.Cpin_6973 gi|256425922|ref|YP_003126575.1| WP_012794537.1.2976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]