SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222054536|ref|YP_002536898.1| from Geobacter daltonii FRC-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222054536|ref|YP_002536898.1|
Domain Number 1 Region: 4-303
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 3.14e-52
Family Nitrous oxide reductase, N-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 241-452
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.00000102
Family Tricorn protease N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222054536|ref|YP_002536898.1|
Sequence length 645
Comment YVTN family beta-propeller repeat protein [Geobacter daltonii FRC-32]
Sequence
MYFRLFTALAGILMCAGYAAAYPFAYIPNPSQNTVSVVDTNGNNYLTPKISLGTGQSPFG
VAVSANGKRVYISNKLSKSISVIDALTDVNNPTVITTISPLANTPSGIAINPAGTRLYVA
NNDAASLTVLDISALTPGTVAPTVLASPAVGNAPVGVAMDPAGTFVYVANSGSDTVSVID
TATNQVSGLPITVGSMPTGIAVGTVGSAVKIFVANQGSDNISIINAVTRAVTPVPVGAFP
YTVAVAPDGSKAYVTNTFGDSISVINTADNSVTTPYLLPLGYSPMGLAITPDGTTLYAVN
NTADAAPGNTSLGSLSSINLYSNAITNLPNTSGNPDFFNSPEALGNFIGPQLYTVTATSD
TNGTVASIDGSKITSEANGNTFTQIVSPGDRPAYVLAPKQYYRVNNIAINGNIIDFRTDT
NYNQTTSTYTFSPVNSDPSIDVTFIKDFDYVSVTRPADTVTANGAITSTPAGINCSASTS
PSLCNVLFQEGASVTILATPNTGKYFVKWVGDRDKNGLLINNGALCDGLTTTSCTFTMST
YTHFTAVFSDTPVNDVVRMLSPGTTFYPTIQGAFNAVTAPTTDIQLALADFPESPNLNVS
GAAFKLSGGWNADKTFTAQGPTPSTITGTLTITQGTLTVDNIAIK
Download sequence
Identical sequences B9M542
WP_012646526.1.88144 gi|222054536|ref|YP_002536898.1| 316067.Geob_1437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]