SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222056805|ref|YP_002539167.1| from Geobacter daltonii FRC-32

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222056805|ref|YP_002539167.1|
Domain Number 1 Region: 87-240
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 1.33e-20
Family Nitrous oxide reductase, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222056805|ref|YP_002539167.1|
Sequence length 969
Comment APHP domain-containing protein [Geobacter daltonii FRC-32]
Sequence
MDCLKKLDRVMRQTITAVMFMGLVVGIAGISVTAQASTITPVKWDNKEDWEKATRLNIDT
TTSPGDVMIGVTKDFVTSATITCVTLNNKIYTTGVDRTSIAVIDARSNTLMPNISLPGRA
AGVVYNSQSNKLYVGQYNDNKVLVIDVTTDTITHTLTVGNGAYAAVYNPKSNKAYIANTA
DQTVTILDGVSDSALITVPVAAGATTASFNAVDNKVYLTSKSNQYMTVIDGVTDQVIKDV
EIDPPLNLLGGQAPGNIGLRVDAPVMGINNANAIHLSWNYATPGANQKIQFQIRTAPDVL
SLDGATYKGPDGSADTWYDVSTSGSETTTETDGSVTTSVPLNVSFTPAAEIQVKLSSDGL
STPVLHSVMLGYESYADLAITRVTGPATGTIESTIDISYEVKNQGAGAADSSKVGFYLTR
DGVDYPLGERTVPSLGPGMSDSTSTTVTIPSIQTGEYYIKACADYTNLVPETDENNNCTT
GNVIRISSIEPDLVVTGVTATASGGKLSYSVTIKNQGIKTAGANSIGIYLSTDQLITKED
TLNSAYYYPSGIPGGSSVTLTSWSYIPINMTGTYYVGAIVDNDNIVPESAENNNSRAGNQ
VTITNDLVVVAGSVSGSVANGMLTCSLKVQNLGNGNASVNYAGIYLSQDEVITNGADTWV
AMAYYNGAIRGGDIVTITGSNYLPPNMTGTYYVGAIADYDNRIPEWNPPVDAESNNSRVG
NQVTITNDLVVVADSVSGSVANGMLTCSLKVQNLGNGNASVNYAGIYLSQDEVITNGADT
WVAMAYYNGAIRGGDIVTITGSNYLPPNMTGTYYVGAIADYDNRIPEWNPPVDAESNNSR
VGNQVTITNDLVVVADSVSGSVANGMLTCSLKVQNLGNGNASVNYAGIYLSQDEVITNGA
DTWVAMAYYNGAIRGGDIVTITGSNYLPPNMTGTYYVGAIADYDNRIPEWNPPVDAESNN
SRVGNAIIL
Download sequence
Identical sequences B9M745
316067.Geob_3728 gi|222056805|ref|YP_002539167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]