SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145590658|ref|YP_001152660.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145590658|ref|YP_001152660.1|
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 5.63e-61
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000116
Further Details:      
 
Domain Number 2 Region: 222-373
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 3.59e-51
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|145590658|ref|YP_001152660.1|
Sequence length 378
Comment acyl-CoA dehydrogenase [Pyrobaculum arsenaticum DSM 13514]
Sequence
MLSEEHKLTIKAIREFVDQYVRPKARSIDKGEYPRQLLRQLGKMNLLASTLPQDVGGAGA
DTLTHILIVEELARASPSLATIMEVQSSMLAENLYHNGNKVHREEVVPKLASGEAVGAFT
LSEPCCGSDAAAIVTRAEKRGGEWVINGTKTWITSGLYADYFLLFARTGSLEARHKAITA
FLLRRSNCIETTPIEVMGVRGTGTAEVKLNDCRAGDDDVVGEVNGGWKIAMWGINMGRLN
VGTIGLGIAEEAFYEAYSYAKKRVAFGKTIAEFQVIQHYLAEMYARVEMLRSFIYSTAKM
KDSGDPNFPLYAQVAKLMGSRTAVDVVRLAVQIQGGYGYSKDSHLEMLYRDAKATEIYEG
ANEIILNTIYKFMREKIA
Download sequence
Identical sequences A4WHZ1
340102.Pars_0407 gi|145590658|ref|YP_001152660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]