SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145591081|ref|YP_001153083.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145591081|ref|YP_001153083.1|
Domain Number 1 Region: 41-321
Classification Level Classification E-value
Superfamily ADC synthase 3.14e-92
Family ADC synthase 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|145591081|ref|YP_001153083.1|
Sequence length 324
Comment anthranilate synthase [Pyrobaculum arsenaticum DSM 13514]
Sequence
MERRGPYAVGLLPFHAVSPFDSAEARRREPWPEALFVVGPPSAPSLRGGGISLRLEEEVP
CGEYEEAVEEAKRALARGELFQLVLSRFKKFKGWATPDAVLKRLAAVMDGKYYFFLEAGD
LWVAGISPETLVSVEEGRAWSSPIGGTRPRGATSEEDLALEAELVNSVKDRAEHIMLVDS
VRNDLGRVCAWGTVSASRVAVVEKFSYVQHLVSYVGCRLARGVTPLRAAAALNPTTTVTG
VPKPRAIEYINALEREPRGPFAGSFGAVWPGGGDFAVVIRSLYGEGDTVYLWGGAGIVMD
SDPKGECRETEVKMGPIARALTSP
Download sequence
Identical sequences A4WJ64
340102.Pars_0846 gi|145591081|ref|YP_001153083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]