SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145592087|ref|YP_001154089.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145592087|ref|YP_001154089.1|
Domain Number 1 Region: 167-288
Classification Level Classification E-value
Superfamily DNA primase core 0.0000000000523
Family DNA primase DnaG catalytic core 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145592087|ref|YP_001154089.1|
Sequence length 405
Comment DNA primase [Pyrobaculum arsenaticum DSM 13514]
Sequence
MGALTIVAKYMIVAQIEVNGSVDKSDIIGALFSQTEGLLGKDMDLRELQMMGRIGRIEVD
IFEKNGKTKAKIYIPSNLDRYETALVAALVESIERVGPYPASVKVIEIRDLREEKRKKII
EKAKELVKLIEEEILPDTKEIIERLKEDVAKAEVVEYGPERLPAGPDVDKSDAIIIVEGR
ADVVNLVKHGYRNVIALEGISRGVPQTIIDLSKKKNVTVFIDGDKGGELVLKELLKVAHV
DYIARAPPGKEVEQLTAKEIAKALRNKISLEEWLAQQKASGERAEAPPQPAQQPQQEQPA
PQRPIQAPFDLEKKIEEMLGTLEAEIYDQNWTLVKRLPVRELPDFLATSGDSIYAIILDG
ITTQRIVDLAAKKGVKVIITARTGPLTKVPEDMSIYTFEQLKKTE
Download sequence
Identical sequences A4WM20
340102.Pars_1886 gi|145592087|ref|YP_001154089.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]