SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|145592323|ref|YP_001154325.1| from Pyrobaculum arsenaticum DSM 13514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|145592323|ref|YP_001154325.1|
Domain Number 1 Region: 205-455
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.61e-68
Family Leukotriene A4 hydrolase catalytic domain 0.0006
Further Details:      
 
Domain Number 2 Region: 18-196
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 3.4e-33
Family Leukotriene A4 hydrolase N-terminal domain 0.00063
Further Details:      
 
Domain Number 3 Region: 540-724
Classification Level Classification E-value
Superfamily ARM repeat 3e-24
Family PBS lyase HEAT-like repeat 0.081
Further Details:      
 
Domain Number 4 Region: 711-787
Classification Level Classification E-value
Superfamily ARM repeat 0.0000265
Family PBS lyase HEAT-like repeat 0.082
Further Details:      
 
Weak hits

Sequence:  gi|145592323|ref|YP_001154325.1|
Domain Number - Region: 792-822
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0327
Family Mitotic arrest deficient-like 1, Mad1 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|145592323|ref|YP_001154325.1|
Sequence length 823
Comment peptidase M1, membrane alanine aminopeptidase [Pyrobaculum arsenaticum DSM 13514]
Sequence
MKYVVGRDFAFPEYLPRYPREYGFDVLYMWLDISIDVHSGVVEGAVRYRVRARKDGVPVV
LDAVEMEVRGASHDYYYDGEKIEIRPSWKKGDEIEVQISYRAKPRAGMYFIKPDKTRRGV
YVWTQGETEYNRYWVPLPDSPNIKFPWRVAVTVPKPYVAGSNGVLVEVRNGGDRNTYVWE
MRHPMSPYLLAIAIGEYEVHKEDCGGVVLEYYIPKYIDDRWRFSFYNTCKIMKFFSEYLG
VPYPYERYAQVVVPEFIYGGMENTTFTILTDWTIHDKHAHCPYTGFPCPEHEDFSSDPLV
AHEMAHMWFGDLVTAKDWAHIAINESFATFIEDLWTEASKGRDEYLYEIYTNFKTYLGEY
TRRYSRPIVTNLYKIPDEVFDRHAYEKGSVVLHMLRSLLGEESFRKGLKLFLERHRYKAV
DMEDLRKAFEEASGRDLEWFWKQFWYSAGHPVVKVSWSYSDGALKLQLRQAQGEDSYPVY
ALPLEVKIVYEDGRKEVREVLLNEKEVTLYVQGGKPRYICVDPRFKLMKSLDLGYPLESA
VAMLEDEDMYCRLQAVEVLKKNGSPKAVDALAKALGDKFWGVAAEAARALGEIGTGAAVA
KLVESYRIVSHPRVRRAIVEALGSAKRKEAAEFLDMVLHDAGESYYVRSEAARSLGRVKW
EFAEYSLKKALEYPSHVDVIKRGALEGLAELGTDEALKIVLRHAEPDMPTPVRATAVQSL
AKFGPRKEVVDAVRMYMRDENFRVRFAAVTAALELLEPKLLPDLQERAEQDIDGRVRRVA
REVAEKIKKFMERGTEYQKLREEVEKLREEYRKLADRVARLER
Download sequence
Identical sequences A4WMQ6
gi|145592323|ref|YP_001154325.1| 340102.Pars_2127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]