SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125716899|ref|YP_001034032.1| from Streptococcus sanguinis SK36

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125716899|ref|YP_001034032.1|
Domain Number 1 Region: 9-220
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.77e-52
Family PP-loop ATPase 0.00035
Further Details:      
 
Domain Number 2 Region: 346-419
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000706
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125716899|ref|YP_001034032.1|
Sequence length 425
Comment PP family ATPase [Streptococcus sanguinis SK36]
Sequence
MIKQEFLKKMQEKKYFQDHRKVLIAVSGGLDSMTLLQLLIVSQKELAIELAIAHVNHKQR
PESDQEEKALVKIAEQLGVKIFTSSFSGNFSENAARQFRYDFFGKVMQEGHYTALVTAHH
ADDQAETVFMRLLRGARLRHLSGMKAVQPFACGELIRPLLTFHKSDFPDIQHFEDSSNFQ
NDYLRNRIRNLYLPDLEKENPQFKDSLRYLGKEIEDWQTALSHLTRDLDIENVQVFHQQI
PQVQRFLLQNYLENFSGLNLSKQQFEEVLNILQTKANYQHTLKKDYELVKDYQRFEIRKI
SRKPDLKMDSILLEFENLIEFGYYRFSFGIPLSGENIQKIFVSRETSLTLRFRKEGDSIL
LNGHHKKLRRLFIDKKVSFEERNSSVVVEQNHQILAILNIAISDLSKALKSDIMSTVLYI
QKIDG
Download sequence
Identical sequences A3CJX7
388919.SSA_0013 YP_001034032.1.98618 gi|125716899|ref|YP_001034032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]