SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125717607|ref|YP_001034740.1| from Streptococcus sanguinis SK36

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125717607|ref|YP_001034740.1|
Domain Number 1 Region: 11-393
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 3.01e-135
Family ArgJ-like 0.0000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125717607|ref|YP_001034740.1|
Sequence length 397
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Streptococcus sanguinis SK36]
Sequence
MKIIDGTIASPLGFSADGLHAGFKKKKLDFGWIVSEVPASVAGVYTTNKVIAAPLLVTKA
TIQKSQKLQAIVVNSGVANSCTGQQGLDAAYEMQRLTAQKLKIEPDLVGLASTGVIGEQL
PMNALKNGLSQILVSGKAEDFAEAILTTDTCTKTCVITEEFGSDLVTMAGVAKGSGMIHP
NMATMLAFITCDANISSATLQAALSQHVETTFNQITVDGDTSTNDMVLVMANGCRQNEEI
LPDTEEFEKFSKMLRYLMADLAKKIAKDGEGATKLIEVNVRHAKDEQSGRMIAKSVVGSS
LVKTAIFGQDPNWGRILAAIGYAGADVSVDNIDIWIEGIPVMQASSPVAFDPEETSDAMA
GELLTLTIDLHDGDAEAQAWGCDLSYDYVKINALYRT
Download sequence
Identical sequences A3CLY5
388919.SSA_0758 YP_001034740.1.98618 gi|125717607|ref|YP_001034740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]