SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|125718149|ref|YP_001035282.1| from Streptococcus sanguinis SK36

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125718149|ref|YP_001035282.1|
Domain Number 1 Region: 93-242
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 3.27e-46
Family PA2201 C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125718149|ref|YP_001035282.1|
Sequence length 248
Comment hypothetical protein SSA_1333 [Streptococcus sanguinis SK36]
Sequence
MAIRDTLSTEKNYKDGLMSNKEALQYFQEKLIKLQIDLDNGIENYKKPTIEVYHSTLATI
LSYQRDILFATYSSGASLSDFKEEYISFVACLVPVWHKEWGYEQMVWALSIGILLEIDEE
IFEQLVDLVKKDDPEDYLIDYLIQSRHPDWKIRINYNFPRPYGFTRKIIEEENAEQALKL
LKEYVTKKWYPGHRDTGWYDLHKANIDNYYGYWSFESGAICKIKGLNYKELEGIPYFPYD
LVAERAEV
Download sequence
Identical sequences A3CNH7
gi|125718149|ref|YP_001035282.1| 388919.SSA_1333 YP_001035282.1.98618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]