SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153938205|ref|YP_001390167.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153938205|ref|YP_001390167.1|
Domain Number 1 Region: 345-821
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.9e-101
Family Phosphate binding protein-like 0.00000693
Further Details:      
 
Domain Number 2 Region: 33-334
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.19e-58
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153938205|ref|YP_001390167.1|
Sequence length 826
Comment methyl-accepting chemotaxis protein/ extracellular solute-binding protein family 5 [Clostridium botulinum F str. Langeland]
Sequence
MFNFKLKRSSIDKNINSLNEKNIEKPCNIAIYEDNLKVLTNNQRKIVDKLDKKIIETDSV
TELLIKMTKDISNYVEMEMNSISKVTGEISNYSAIAEEVFSSTENSKQISESTMEVAKEG
NGAALNSIEAMKEIEGSMLYSKTVVKDLSTKALDINNMLDVIKDIANNTNLLSLNASIEA
ARAGEAGKGFAVVAHEVKKLAERSMDSVDFIGNNIKEINISIDNAIKAINETMNKVKEGT
EIANKTMETFNSIISSIKTSASVSEEINDAITKQIGHLENVINSTEEMNTTSEKLMFIVE
LASLNTQYTKTSLKDLSEVSQNLKYISNNLLNEIEVDSKENNVILNTYIDGRPLYLDPAL
SYELNSSLLLNNIHIGLLTINSYGEISPGIAKSWYLEKDNLTWVFNLKKGIKFHNGKEVT
SEDVKFSLERLLDPKLDSPNGWLLEIIEGSEDFKKGAAKHVSGIKILDKHRISLTLSYSY
SGFLLNLGLELCGIINKDSINQGDVVGCGPYKISEFNDEGCKLEAFKEYFNGAPYIDIIN
INFKSESPIDDFLNKDLDVLTINDKNEYTTLCSNKNINLIEQDLLATYYASFNMKSNSIF
SRDKDVRYALNLAIDKNRIIKDILGGLGVEAKGPFPPSIIPNNKLRGFSHNKSKAKEILS
RSDFNRSRDKLNILIRKDEDSLFSKITEYILEDLKNIGIDCIVKEVNSSEYLNLDNILKC
DMAISRWCADSGDPDNFLEPIFNIENVSNISRYDNKLVNEKLKVAKNLINPEKRKKLYEE
IQEIIVEDVPWIFLYHPKLAIAVQNNILGLNANPLGLFKYEDIIKN
Download sequence
Identical sequences A7GBK7
WP_011987750.1.24613 WP_011987750.1.68062 WP_011987750.1.82254 WP_011987750.1.96435 gi|153938205|ref|YP_001390167.1| 441772.CLI_0896 gi|384461242|ref|YP_005673837.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]