SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153939574|ref|YP_001390340.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153939574|ref|YP_001390340.1|
Domain Number 1 Region: 190-430
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000445
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Weak hits

Sequence:  gi|153939574|ref|YP_001390340.1|
Domain Number - Region: 549-621
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00366
Family Calcium ATPase, transmembrane domain M 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153939574|ref|YP_001390340.1|
Sequence length 719
Comment phage infection protein [Clostridium botulinum F str. Langeland]
Sequence
MKKAFRIFSRDLKNIVKHPAAIIVVLGLSFIPSLYAWINIKACWDPYANTGNLPIAIVNR
DEGMMLRGKYTNVGNGIVENLKGNKNMGWVFVDEWQANYGLNEGKYYALIEIPSNFTRGL
ASLKTTDPQKPNIIYRANEKSNAIATKITNAAKGSLAKQIQTNFVYTVNKEAFKLLNNTG
GQLEKNKSKILGIKSTLELGNKSIGEVKNIIDDASKDSESLKQYFNDTKDKLPLITDQIN
NLQKATEASKNLVNETERDLNGIAKNINNDMIYRESTNSKINSILTNLKEYNNVSNNSEM
IKLVDEASKLCDSINSNIDGTIKSLEVVNILKPNKIIEELISSLKNLQEKVNGEKNKLAE
LKNKISTSNNNKQNINQVVESILLLNDEINKNMRNTSNIFYNQTTMIIENTAKGLNNRLD
TANDILDTTKLVIPQLKALGDFGVGTSDAALKDGKKINNKLAEFKKTINKLEEKTSSLTE
DNLDKIINLTQKNPEQMASFISSPINIKEEEIYNTGIFGVGLTPFYTVLAIWVGVLLMSS
LISVEAEEFEGEKKLTHLQVYFGKLLLFLSIAIIQGIIVTLGDVFILGIEPASMGLLMVF
TIVTAITFTFIIYTLVSIFGNLGKAIAVVIMVFQIAGAGGIYPIQTNPKIFGVLQPLWPF
TYAIAGFREAIAGPVRAAVIKNLGALFIFSIGSLLLVVLKKPLHKVTEYMNDKFIETGL
Download sequence
Identical sequences A7GC30
gi|384461412|ref|YP_005674007.1| WP_011987908.1.24613 WP_011987908.1.68062 WP_011987908.1.82254 WP_011987908.1.96435 441772.CLI_1074 gi|153939574|ref|YP_001390340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]