SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153939903|ref|YP_001390041.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153939903|ref|YP_001390041.1|
Domain Number 1 Region: 340-367,400-669
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.58e-68
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 94-161
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00001
Family Sensory domain of two-component sensor kinase 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153939903|ref|YP_001390041.1|
Sequence length 670
Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence
MKSLKTRLITIFTTIIFVLTVVLGFIVVNRVSKNLTEDYYDDLQNLAVEKSNYIKSKIDS
EMFYIEAIAQDDKIISKDISWEKKADYFEKEAKRAGYMYYSYVDKNGNSTLFNKKRDTVN
VKDRDYYKKAMSGKSAISDIIISAVTKKPTIIVASPIIKSGQIQGVFYGAKEATFLSDIV
SKIEYGKTGFGIIVNDKGTTVGHANKKLVLSQSNTVEIAKKDPSFKSLADLIENIISQKK
VGNGEYEYEGTKNAVGFSPIEGTNWTMVFGGEISEVLTDVHSIRNIIIVLSLMIIVIGAL
VIYFISGTIVSPIIAVTKRMNELSNLNFTISGNEDAIKYLNRKDEIGSMARAVRKMRDNV
AEFITKTDESAQQIVATSEELTATSQQSATASEEVAKTIEDIAKGSGNQAQDTQNSASSV
EEMGSLLEQNKEYVKELNNAAKDIEEKKEEGFSILKELIGKTKENNEAATNIYEIILSNN
ESAEKIDSASSMIQSIADQTNLLALNAAIEAARAGEHGKGFAVVADEIRKLAEQSNSFTE
EIKKVIEELKKKSQNAVDKMEEVKEINQYQSESVKGTEEKFKKIAYSIDVTNNVIEKLNK
SEEKMNQNKEKLMNLMQNLSAIAEENAAGTEEASASIEEQAASIEEIANSSEGLARIAEE
LDSLIKKFKV
Download sequence
Identical sequences A7GB81
gi|384461108|ref|YP_005673703.1| 441772.CLI_0762 gi|153939903|ref|YP_001390041.1| WP_011987636.1.24613 WP_011987636.1.68062 WP_011987636.1.82254 WP_011987636.1.96435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]