SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153939918|ref|YP_001390870.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153939918|ref|YP_001390870.1|
Domain Number 1 Region: 360-387,420-689
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.44e-64
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000215
Further Details:      
 
Weak hits

Sequence:  gi|153939918|ref|YP_001390870.1|
Domain Number - Region: 143-211
Classification Level Classification E-value
Superfamily Sensory domain-like 0.000154
Family YkuI C-terminal domain-like 0.079
Further Details:      
 
Domain Number - Region: 193-277
Classification Level Classification E-value
Superfamily Flagellar hook protein flgE 0.0275
Family Flagellar hook protein flgE 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153939918|ref|YP_001390870.1|
Sequence length 690
Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence
MKKNSSIKNKLIISFVSLILVSLVLLGSIVYTKVYNQTKEDYAQSIEKQITQVDTSFNNY
IVAFEENIDMFSKGLNNLDKQVTSYVDKKYQSNEIPMTPLKNGSFEASLYKEFENFTKTH
DGIETLSISSESNGGYMQYPAISRKKGYDPRTRDWYNEAKKNKDKVSFTGVYKTSSGSMV
MSVINPVKDLNSNFKGVMTFDINLKKLSEMSKNTKIGENGYLIVTDEKGTIIASGKDESL
VSKNIKELKVENLNNLSKYKNNSFSTKMGNGKEYFINVKKSSNEKLGWYYISFVEKAELT
RSANSIGLITLIFTIMFSIVAVLVCIFISNKISQPIKYAAEHIKEMGKGNFTIPIEEKYF
KLEDEIGDIIKSLYRMQDSIKSMLGKVKESSEVVSEEGEKLLSASEEMTGSSSEVSNAIH
DVAVGISNQAGELVKATTTISSFGERLDMVVGELSSISKNSVSINLVANDSNKKMVNMIV
SVKNIEEFFKDFLNVISKLDNNVGQISEMTNLINSISEQTNLLALNAAIEAARAGESGKG
FAVVADEIRKLAERSKESSESINKLVENIDKDKKDIINNTEKMKEELDSQSKTIEETIDV
FKNIIEAIEDIVPKIQNVNSSAYSINEEKDEVLSKMEGSSAISEEISASSEEISASSEEM
HNCSKDVSISAEKLSEMTRAMNEEVNKFKI
Download sequence
Identical sequences A7GDL0
WP_012099637.1.24613 WP_012099637.1.68062 WP_012099637.1.96435 441772.CLI_1606 gi|153939918|ref|YP_001390870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]