SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153939974|ref|YP_001392912.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153939974|ref|YP_001392912.1|
Domain Number 1 Region: 299-596
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.92e-57
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00014
Further Details:      
 
Domain Number 2 Region: 1-181
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.67e-44
Family H-NOX domain 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153939974|ref|YP_001392912.1|
Sequence length 598
Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence
MKGTVVATWVKTCRKLYGEEAVDKAMNAVGWQGKIFSPMENVEDTKVKNMINEIASNVNK
DVKTLWGQIGQDNLKAFNNDYPAFFEHENLYSFLKSMFDVHIVMTKKFPGAKPPLLTIEP
ISEKEAIFSYSSKRGMFDYFLGLLKGSAEHFKENIKVDEIERKGDFLKLKLTFEKNIYYN
KTFKFNKILSLGFIKNIGGKVALFTFILTILSSLALLGFNNLFKVLSLSFISSFAAYIST
EILLKPKYLIFEEINKINKNHYVEDGDIKTGDFLEELYKELKKHKDIIKADFVGFKGVTD
EMNTFVGNINVISETMSHTSTEISGVVEQVASCAVNQAENTEQVVAVLNNNIQNLKDIVN
SENSNKLELEKALEKVNNSYNNVNNTSKNILDSLEKFQKVKDKGLELETKAKDITNIVSI
VSGISEQTNLLALNASIEAARAGEQGKGFAVVAEEVRKLAEQSKEAVEEINNNLIEFAGD
IKNLVIRIESQYNVLEQETDRLEEVRDISYGATTSIGTVASAMIKTINELNKEADSISSI
YDNIESLAAIAEENSASSEEVSANVSSYTNEIKKLVNNIHEFKQITETFKSDLSRYKI
Download sequence
Identical sequences A0A2G7HE52 A7GJF2 B1IH14
WP_012101172.1.21789 WP_012101172.1.24613 WP_012101172.1.68062 WP_012101172.1.82254 WP_012101172.1.96435 gi|170755275|ref|YP_001783197.1| gi|153939974|ref|YP_001392912.1| 441772.CLI_3780 498213.CLD_0925 gi|384463871|ref|YP_005676466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]