SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153939986|ref|YP_001390717.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153939986|ref|YP_001390717.1|
Domain Number 1 Region: 241-268,301-571
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 7.67e-54
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153939986|ref|YP_001390717.1|
Sequence length 572
Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence
MENLKVKNKILFMSSIMLIFTIIVGITGYYFNAKSNKAIKKLYEDNLISVKVLNDARAQA
RGAEADVARIVILSKDVKTQEKLKKDIESRVEKFNKDIEEFKRIGLNSEKEKELLDYMEK
NLNEFRQRREEVFKVAKEGKMDLAAKKFSELNEVNENYQKALIELSDFNVKEAEEFKIQN
DRANAFSNRFITIILSLSIVIALVTTNIISKSIINPLKESVEYLDKLSTGNFTEKVSDKL
LKRKDEVGQLANAVSKMYGSIKNIINDVLNEMSNSSNVVENIDENINDLNKRIQEASTAT
EELSASMEETGASAEEMSATSEEIEKAVEDIALKAEEGASSAGKILNKVEELKSDAIKSQ
KNANKVKANIDSATKDAIEKSKTIEEINVLSEAILEITSQTNLLALNAAIEAARAGESGK
GFAVVAEEIRKLAEQSSQTVVRIQDTTKEVLKAVEDLKKNSSNALNFIDSYIVKAHQDTV
EVFDSYSKDATYYNDISNDLSATSEELLASIKNIVEVINNVADAANEGAKDTTNIAQNNE
KIVIASEDIVKSTDLLKNSSQKLINSVTKFKI
Download sequence
Identical sequences A7GD57
441772.CLI_1452 WP_011988208.1.24613 WP_011988208.1.68062 WP_011988208.1.82254 WP_011988208.1.96435 gi|153939986|ref|YP_001390717.1| gi|384461774|ref|YP_005674369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]