SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153940069|ref|YP_001389873.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153940069|ref|YP_001389873.1|
Domain Number 1 Region: 337-371,404-673
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 7.98e-52
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000915
Further Details:      
 
Domain Number 2 Region: 48-186
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000314
Family Sensory domain of two-component sensor kinase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153940069|ref|YP_001389873.1|
Sequence length 676
Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence
MKFKFKNTKDKNFISVKSVINIQILGLIILICGILGIVSYKSASKALTKNIKMELENKAK
NGSTILGNRMNEVKERLQIIANWPEIKSMDLKNQKYQLEDEAKSWGFKDFKIVNLQGNQY
TMNSNEIENISGKGYFNRILKGDTFIIDSDIDKNTNVPLIKVVVPIKSNDEKVVGALIGS
LDIKDINKLVNDAKSNNKEEIGFVINKEGYYIADGDINLVLKRGNDLKNYSNDPKFVELL
DFQKKMINGENGFGEYKYNNIRRFMAYVPVPGTEWSMAIAVEKNYLFKDIYTLRIVILIS
TILFIILGIIISNIISKNIKDPLVKMKEHAEQLEKCNLTYKNSINRKDEFGETARALNEA
SNILNQTINSVKKESQNILQSSNCAKETFDKVNAEVQQITAFTEEISANMEESSAGIEEM
ASMTSSVKEDMSITKKKAKEGLDLAINIKEKAESVNEDACSSMSEVEKIYENSKEKLEKA
IREAQVVENISEMAESILGIAEKTNLLALNAAIEAARAGEQGRGFAVVAEEVRKLAEQSS
NAVENIQVNVKTVLKAVSELSSSSEFVLELIEENVLRDYKKLIDMSVQYKNDGNIVKELI
ENFSNLSEKTSKAIEQIAIGMEGMSGSVIEVAESSSEIAEKISNVNQQNELILQENEKNL
EISQQLVNTMNEFQSI
Download sequence
Identical sequences A7GAR3
gi|384460939|ref|YP_005673534.1| WP_011987495.1.24613 WP_011987495.1.68062 WP_011987495.1.82254 WP_011987495.1.96435 gi|153940069|ref|YP_001389873.1| 441772.CLI_0588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]