SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153940101|ref|YP_001391028.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153940101|ref|YP_001391028.1|
Domain Number 1 Region: 327-363,396-665
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.66e-66
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000025
Further Details:      
 
Domain Number 2 Region: 108-162
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000217
Family YkuI C-terminal domain-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153940101|ref|YP_001391028.1|
Sequence length 667
Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence
MKFKTMKGKMLTYFLSLFLIICIAISFMAYFMSKRMIERKASSLMSEVSRQAVQNIEARL
NGTLDSIETVANMPTIKDPKLGWDKKKTILDEEIKLHGHVKMGIVGKDGQSIQTDGTTVN
IKDRNYFKETMEGKRTISEPIVSKVDGKVVIIYTVPIKNGNTIMGALTAVREGNDISNIS
NSIKVGESGGAYLIDSTGTVIAHKNKESVIKRENSIKDAQSNEELKPIAAIEKSMIEGKE
GIGQYKYKGAEKYISYSPMKSTGWSLAIYAPKNEILKEVSEITRNIIIVSILGIGIALVC
IWFISTQISNNLISMRDSLNIVATGDLTTNVDSKIEKEKDEIGHMARALSKTVLSIGNMI
NSLKGSSFNIDDKANNLAAISEEFTATTENVSTAIQEVATGATNQAQALTEIVSMLNDFS
DKINSTVNNIEEIDGMSKEIDEKANVSNKDMKELLNSIENLTKVFENFETKIWTMESNVQ
KINEITNLINDIAEKTNLLALNAAIEAARAGESGKGFAVVAEEIRKLAEMSRKSSEDIYT
IVNGVLEDTKDMVKSSNEVNEKLNGQRSTADEAMNSFMEISKSVTNMIPKIRNINNSANI
IEKNKNEILNKSETIASISQEISASAEEISASSEEMSASSEEVANTAQSLNDMTQDMLNE
MNKFKTE
Download sequence
Identical sequences A7GE18
gi|153940101|ref|YP_001391028.1| gi|384462067|ref|YP_005674662.1| WP_012099771.1.24613 WP_012099771.1.68062 WP_012099771.1.82254 WP_012099771.1.96435 441772.CLI_1768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]