SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153940441|ref|YP_001392087.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153940441|ref|YP_001392087.1|
Domain Number 1 Region: 279-330
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000000000185
Family MLTA-like 0.0091
Further Details:      
 
Weak hits

Sequence:  gi|153940441|ref|YP_001392087.1|
Domain Number - Region: 36-103
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0034
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153940441|ref|YP_001392087.1|
Sequence length 341
Comment hypothetical protein CLI_2859 [Clostridium botulinum F str. Langeland]
Sequence
MNKKVLSFIIMLNLILSIGSNVLAAPSIKESDDLKETREQKKQIQQRVEKMDSEIDSVIN
EIDKNKQLMNKVNNDVKDTENKLNQVKNNVKEKEELFGKRVRAMYISGGDSYLDILLGSE
NLSDFMSRVDTVSKIMKFDVNVVTKLKEEKEAIAKQKENLDQEKNKLSALKKNNEVALLR
LNKNVEEEKRALSKVNEKESELVANEAARAEEARKAEESSKKAKEVASSDSNSSKGQTLS
RGESNSMSYSKVVVVEATAYAGDSATASGEKPNRNPNGYSTIAVDPRVIPWGARVYVEGY
GYAIAHDTGGDIKGNRIDLFMNSEAECNSWGRRSVKVYILG
Download sequence
Identical sequences A7GH27
gi|153940441|ref|YP_001392087.1| gi|384463079|ref|YP_005675674.1| 441772.CLI_2859 WP_012100610.1.24613 WP_012100610.1.68062 WP_012100610.1.82254 WP_012100610.1.96435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]