SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153940506|ref|YP_001392507.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153940506|ref|YP_001392507.1|
Domain Number 1 Region: 9-69
Classification Level Classification E-value
Superfamily Replisome organizer (g39p helicase loader/inhibitor protein) 0.0000235
Family Replisome organizer (g39p helicase loader/inhibitor protein) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153940506|ref|YP_001392507.1|
Sequence length 180
Comment hypothetical protein CLI_3295 [Clostridium botulinum F str. Langeland]
Sequence
MIPEETIKILSIIKAAYPQWARDLKPTDAKTMVNLWSTMLEDYPYNVVQIAIKKIIATNK
FPPSVAEVIEAINYITSGGKSEMTEIEAWGLVRKAIKNSAYNAEEEFNKLPSRIQEAIGS
HNILHNWSQESINGIETVIGSNFMRSYKQTVIRKKEEKQIPTSIKKMLGNVGQKMIEGDK
Download sequence
Identical sequences A7GI97
gi|384463477|ref|YP_005676072.1| WP_012100924.1.24613 WP_012100924.1.68062 WP_012100924.1.82254 WP_012100924.1.96435 441772.CLI_3295 gi|153940506|ref|YP_001392507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]