SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153940902|ref|YP_001390079.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153940902|ref|YP_001390079.1|
Domain Number 1 Region: 220-485
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.66e-51
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153940902|ref|YP_001390079.1|
Sequence length 488
Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence
MDYKKNAELKNKIMLAGFIASVALRAIFDIILKVDRNAILILVGLSIPLAIIDFILIKKK
CIIQTMYYTVMMYTAVICIMFISDPNWANFILIYYGVILMSVYQDLKILIIEAILATVLV
VYFFLGYKTTLFASVGYYELVFYISYIVAGSAILSINAITTKSIYKDLEETHKATEEAKS
RAELLLEKIYSTIKVLTATNEKIKSGISVAGQIAEEITSSTSDVANSAAKEVDVMIEMKS
SIEGGAEKAEEVTSCIKTMEELSKSTENVVLEGNNKVDILYSEMNKVNKNILSVVSMINE
LSDENTKIVHIINSITKISEQTNLLALNASIEAARAGEYGKSFAVVAEEVRKLAEDSKES
TDQIELILNNISNKTKVVAEEILKEEKSIELCNEHTNDVKELFKDVNKNTSNVLSYSSSV
GSQSMLLESTMKNTLSSVNNISETVESTATAMEEIFTAIDELNNSIIGITSSYDEIDDIC
NELNSISE
Download sequence
Identical sequences A7GBB9
gi|153940902|ref|YP_001390079.1| gi|384461155|ref|YP_005673750.1| 441772.CLI_0807 WP_011987672.1.24613 WP_011987672.1.68062 WP_011987672.1.82254 WP_011987672.1.96435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]