SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153941405|ref|YP_001392206.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|153941405|ref|YP_001392206.1|
Domain Number - Region: 221-391
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0628
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153941405|ref|YP_001392206.1|
Sequence length 720
Comment phage infection protein [Clostridium botulinum F str. Langeland]
Sequence
MKNIFKIYKRDLQNIITNWVAIVVMLGLMILPSLYAWFNIKSSWDPYSNTKSISVAVVSK
DKAAFFKGQSINAGEELVNKLKINKNIGWKFVDEKEAEKGVKYGKYYASIIIPEDFSYKI
LSITRDKQEKPTLIYSVNEKSNAVAPKITSKGVTTIQSEVTKTFVKTVNGIIFEMFNKLG
IELEKGKPKLKDLMNMIFYVNDKIPEINASIDKLEKGAITLEEFIEKINKDIPLIKDTIN
RALSAGDKTKLFLSKSKEGINNVAPYIKQDLIIARKINSTAEVLIEEGVDLIGKNSSKAR
ENLLSSKDKLTNVKEILNSILELIDIINKDKKNIIMNDFENNIKDMKERVNNKIENINTV
ISSIDRGEKVSVEVLNRLNNKANGIDSILEKTIEDFNPKIVPAINNVLNDLIVVADNTIQ
LLKNANENLPGATELLDKGYTGAEKGIKGIKILKSNLPSIEKSIGEVSNKLKTLDDDERL
NEIIKLMKSNAKIESDFISNPVEIKENRIYPIPNYGSAMAPFFTTLSLWVGALILVSILS
VEVKDIKGAKKLKVHEKYFGRYFTFMTIAIFQALIVSLGDIYLLKVYVSNKSIFILFSIF
ISIIFSMIIYTLVSVFGNVGKALGVILLVLQISASGGTFPIEVTPGFFQRINPLLPFTYA
VSGMREAVGGVIEGILLRDIIILLIYFTLSILLALLLKKKLEKINKNFVKKFKESGLVEE
Download sequence
Identical sequences A7GHE6
441772.CLI_2981 WP_012100709.1.24613 WP_012100709.1.68062 WP_012100709.1.82254 WP_012100709.1.96435 gi|153941405|ref|YP_001392206.1| gi|384463187|ref|YP_005675782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]