SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153940555|ref|YP_001390904.1| from Clostridium botulinum F str. Langeland

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153940555|ref|YP_001390904.1|
Domain Number 1 Region: 40-308
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.01e-55
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153940555|ref|YP_001390904.1|
Sequence length 318
Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence
MINIFSKKDSKKDNKNDTIEQEVIVEEKHEVETIDTMKFLKEMTIQIEGIIQQHNKVNGE
HEVLEKLAKQIENHMVTVSNLTERTNESTDKLFSQGESLLEITKDTVNKSLEGKKSIEGM
VKVIENLDIETKDTYENINALGEKLKEIGEIAQLISGIASKTNLLALNAAIEAARAGEQG
KGFAVVADEVRKLAEMTGESSSNITNLISGIDSQTKNVLNSVEKSTLVVTEGVKSSKGAL
EKIEEVLDSFNRVEDDTDSLIKTINTQKEDISKIFNGINGVDKILTETNEQIIKHIDEAH
KVDEKLEKSVYHIAQYVK
Download sequence
Identical sequences A0A1V9IV50 A0A2I4NMQ2 A7GDP4 C1FN29
441772.CLI_1641 536232.CLM_1800 WP_012099663.1.100585 WP_012099663.1.101508 WP_012099663.1.14863 WP_012099663.1.15773 WP_012099663.1.16999 WP_012099663.1.17118 WP_012099663.1.19081 WP_012099663.1.19327 WP_012099663.1.24613 WP_012099663.1.27859 WP_012099663.1.32894 WP_012099663.1.36253 WP_012099663.1.42818 WP_012099663.1.45672 WP_012099663.1.46996 WP_012099663.1.47789 WP_012099663.1.49498 WP_012099663.1.49610 WP_012099663.1.51581 WP_012099663.1.52741 WP_012099663.1.57050 WP_012099663.1.59839 WP_012099663.1.63039 WP_012099663.1.68062 WP_012099663.1.69692 WP_012099663.1.70928 WP_012099663.1.77051 WP_012099663.1.82254 WP_012099663.1.87856 WP_012099663.1.90975 WP_012099663.1.9205 WP_012099663.1.93232 WP_012099663.1.94833 WP_012099663.1.95223 WP_012099663.1.95482 WP_012099663.1.96416 WP_012099663.1.96435 gi|384461948|ref|YP_005674543.1| gi|226948890|ref|YP_002803981.1| gi|153940555|ref|YP_001390904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]