SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150025120|ref|YP_001295946.1| from Flavobacterium psychrophilum JIP02/86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150025120|ref|YP_001295946.1|
Domain Number 1 Region: 215-409
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.88e-68
Family B3/B4 domain of PheRS, PheT 0.00000872
Further Details:      
 
Domain Number 2 Region: 44-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-42
Family Myf domain 0.0045
Further Details:      
 
Domain Number 3 Region: 708-806
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.58e-30
Family Anticodon-binding domain of PheRS 0.0011
Further Details:      
 
Domain Number 4 Region: 480-699
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.29e-29
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.001
Further Details:      
 
Domain Number 5 Region: 416-488
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000128
Family Domains B1 and B5 of PheRS-beta, PheT 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150025120|ref|YP_001295946.1|
Sequence length 806
Comment Phenylalanine--tRNA ligase beta subunit [Flavobacterium psychrophilum JIP02/86]
Sequence
MKISYNWLKQFIKTDWDSEKTASMLTDLGLEIEAIEKYQSIKGGLEGIVVGHVLTCIQHP
NADKLKITTVDLGDGNPIQIVCGASNVAAGQKVPVATIGTILYDKEGKSFEIKKGKIRGE
ESHGMICAEDELGLGHSHEGIMILDEKLTPGTPAAAVFNIENDEVFEIGLTPNRADAMSH
WGTARDLKAGMLQNGTNIELITPSVSNFKIEKRTLKIDVKVDDNKLVPRYCGVTISDIKI
GISPAWLQNRLKAIGITPKNNVVDVTNYVLHELGQPLHAFDATKINGKIIIKNVAEGTKF
TTLDDVERSLSTEDIMICDENGPLCIAGVLGGKDSGVSQNTTSIFLESAYFNAVSVRKTA
KRHTISTDASFRFERGIDPSITEYALKRAAILICEVSGGQITSDIIDIYPKKIEDHQVML
NIEKVNKIIGQEIPDDTIKKILASLDIKVNSISKVALGLVIPAYRVDVTREIDVIEEILR
VYGYNNINFTQKLNATTSHSSRTEDYKIQNIIANLLVANGFNEMMANSLTTPTYTSLSDS
LNESNNVLIINSLSNDLSAMRQSLLFSGLEAISFNINRKNSDLRLFEFGKTYHKLLSGNQ
ENSHLTLFMTGNKISESWTNPQKASDFFLFKGYVLAILERLGLSKIISSPLNTDVFAEGM
VYEMGNSTLVEFGTVKKSILKHFDIKQEVFFADFNWNSIIKQISNNIKFTEISKYPEVRR
DLALLIDNEIQFVQLFDIAKKTEKNLLKNINLFDVYEGKNLPEGKKSYAISFILQDNAKT
LTDAQIDKVMSKLTQNFETELGATLR
Download sequence
Identical sequences A0A075RUL7 A6GYG2
gi|150025120|ref|YP_001295946.1| 402612.FP1041 WP_011963186.1.100426 WP_011963186.1.10377 WP_011963186.1.15665 WP_011963186.1.16958 WP_011963186.1.22253 WP_011963186.1.27336 WP_011963186.1.27491 WP_011963186.1.30756 WP_011963186.1.30825 WP_011963186.1.31486 WP_011963186.1.32945 WP_011963186.1.3641 WP_011963186.1.40914 WP_011963186.1.43917 WP_011963186.1.45424 WP_011963186.1.50511 WP_011963186.1.53635 WP_011963186.1.61602 WP_011963186.1.68717 WP_011963186.1.73469 WP_011963186.1.75146 WP_011963186.1.76480 WP_011963186.1.76736 WP_011963186.1.8427 WP_011963186.1.87756 WP_011963186.1.90531 WP_011963186.1.91006 WP_011963186.1.94014 WP_011963186.1.94582 WP_011963186.1.94875 YP_001295946.1.27502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]