SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150025676|ref|YP_001296502.1| from Flavobacterium psychrophilum JIP02/86

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150025676|ref|YP_001296502.1|
Domain Number 1 Region: 5-203
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.96e-55
Family PP-loop ATPase 0.0000185
Further Details:      
 
Domain Number 2 Region: 348-429
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000000523
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.037
Further Details:      
 
Weak hits

Sequence:  gi|150025676|ref|YP_001296502.1|
Domain Number - Region: 207-297
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0445
Family MesJ substrate recognition domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150025676|ref|YP_001296502.1|
Sequence length 434
Comment tRNA(Ile)-lysidine synthase [Flavobacterium psychrophilum JIP02/86]
Sequence
MLLKLENHLTKNLPFLKEKKLLLATSGGIDSMVMLHLFQKLNYNIAIAHCNFQLRGLESF
GDQQFVQEYASKNKIPAFVTHFDTENFAKDYKLSTQIAARELRYNWFYELLETENFDFIL
TAHHADDNLETFIINLTRGTGLDGLTGIPEQNEQIIRPLLPFSRSEIEEYTKENSIQWRE
DSSNASDKYLRNKIRHDLIPILKVLNPNFLDSFLKTQNYLQEAQVMIEDATIMIYQQVAK
EDNEIISFDLKKLTQLPNYKSYLYQWLREYDFTAWEDIYNLVESQSGKQIFSKKYRLLKD
RDFLILSVIKELENEAYFIKTNQKEVKIPLNFSICKVNDISSPKNTIIFVDEDKLQFPLT
IRKRNEGDSFYPSGMKGKKKLSKYFKDEKMSLIEKENTWLLCSKNKIVWVIGKRADQQFV
ANKTTQNIIKLELL
Download sequence
Identical sequences A0A076P1T8 A6H020
WP_011963738.1.100426 WP_011963738.1.10377 WP_011963738.1.10561 WP_011963738.1.15571 WP_011963738.1.15665 WP_011963738.1.16958 WP_011963738.1.22253 WP_011963738.1.27336 WP_011963738.1.27491 WP_011963738.1.2967 WP_011963738.1.30756 WP_011963738.1.30825 WP_011963738.1.31486 WP_011963738.1.32945 WP_011963738.1.33550 WP_011963738.1.3641 WP_011963738.1.40553 WP_011963738.1.40914 WP_011963738.1.43917 WP_011963738.1.45424 WP_011963738.1.50272 WP_011963738.1.50511 WP_011963738.1.53635 WP_011963738.1.53668 WP_011963738.1.61602 WP_011963738.1.68368 WP_011963738.1.68717 WP_011963738.1.68719 WP_011963738.1.73469 WP_011963738.1.74858 WP_011963738.1.75146 WP_011963738.1.76480 WP_011963738.1.76736 WP_011963738.1.80382 WP_011963738.1.8427 WP_011963738.1.87512 WP_011963738.1.87756 WP_011963738.1.90531 WP_011963738.1.91006 WP_011963738.1.94014 WP_011963738.1.94582 WP_011963738.1.94751 WP_011963738.1.94875 YP_001296502.1.27502 402612.FP1626 gi|150025676|ref|YP_001296502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]