SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025038|ref|YP_908883.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025038|ref|YP_908883.1|
Domain Number 1 Region: 294-479
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.21e-35
Family 1,4-beta-N-acetylmuraminidase 0.0076
Further Details:      
 
Domain Number 2 Region: 228-285
Classification Level Classification E-value
Superfamily PGBD-like 0.0000107
Family MMP N-terminal domain 0.055
Further Details:      
 
Weak hits

Sequence:  gi|119025038|ref|YP_908883.1|
Domain Number - Region: 82-141
Classification Level Classification E-value
Superfamily PGBD-like 0.000989
Family MMP N-terminal domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119025038|ref|YP_908883.1|
Sequence length 798
Comment hypothetical protein BAD_0020 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTDQMVLQTQQWLNKTYGNDPRFKKINPDGRTGWPTIYALTRALQIELGIQSTADNFGPS
TQRLFKQRYPNGVRQQAVADKSTSNVYSIIQGALWCKGYSTGGNISQHFYDGTGSAIRKL
KADMGIEGDSSVDVEIMGALLSMKQFVLLASYGGIDSVRRAQQFINKAYRPYTGIIPTDG
LYGREMNTALIQVLQSLEGFSPSEATGNFGNGTRSRLKTITANNASSNESWVWLASTALA
CNGIGGGPTFVWTSTFANIVKAFQERYAIAVTGSIDSTTWMSLLTSKGDPDRPCVACDTR
FEITDARLATLKADGYEIVGRYLTEPGQSSLAPKDYFKAIRPGELERITRGGMRFFPIFQ
EYSTKLEHFTPANGAAHAKTAREAAQRLGIPPTHIYFAVDFDATDDQVTSNILPYFRAVC
SSLGGGYGVGIYASRNICSRVIGAGCASNAFVSDMSTGFSGNLGFPIPDGWVYDQFTEID
DYKGQGWDLDRVAYSGKVSACASLLPAVPVPAPDPDPVSPETDPLLRWVAVTEQECRKAL
AALGTQVAVYEDSIGQFILEWLRKPEYWSEGGSGTQAMWHAYTPEVSTPPDLDAARVVCA
NVCEAQPSIKEKLPSTRDVAHMAATALGYLTWGIENNPAKYGLGDLGGWPLDLLQIWGAY
RRDGKHADLAAWLYKHLGKDEGFGYDDVLADADAWLIASSMRKRSGSTVLSAAMRETFKQ
SETHRIVRFYDERFASSADNVVSAYSTMADGLDALGLTNIGMSESILKKAAGTDKLPDKQ
EAEVSARAFAAFIDQPRR
Download sequence
Identical sequences A0A0L7BX47 A0A1D7UKZ9 A0A1X2Z602 A0ZZB8 E5XXV6 E8MG06 T2HZA4 V6XU18
367928.BAD_0020 gi|322690231|ref|YP_004219801.1| WP_008783074.1.16764 WP_008783074.1.19800 WP_008783074.1.26381 WP_008783074.1.35161 WP_008783074.1.36503 WP_008783074.1.40778 WP_008783074.1.49187 WP_008783074.1.49359 WP_008783074.1.49397 WP_008783074.1.6218 WP_008783074.1.68920 WP_008783074.1.7383 WP_008783074.1.76388 WP_008783074.1.79337 WP_008783074.1.94003 WP_008783074.1.96408 WP_008783074.1.99105 gi|119025038|ref|YP_908883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]