SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025056|ref|YP_908901.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025056|ref|YP_908901.1|
Domain Number 1 Region: 10-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-78
Family Protein kinases, catalytic subunit 0.000000136
Further Details:      
 
Domain Number 2 Region: 605-661
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000549
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0095
Further Details:      
 
Weak hits

Sequence:  gi|119025056|ref|YP_908901.1|
Domain Number - Region: 470-532
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00196
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number - Region: 402-464
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00501
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025056|ref|YP_908901.1|
Sequence length 686
Comment serine-threonine protein kinase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MNINMPTSLAGGRYQLGQLVGRGGMAEVHVATDTRLGRTVAVKIMRADFATDSIFLERFR
REAHSVAQMNNPNIVNIYDSGEETVTTETGEIEHLPYLVMEYVKGQTLRDILKVNGALSQ
RDAEQVMMGVLNALEYSHRMGIIHRDIKPGNIMISEQGVVKVMDFGIARAIDDSAATMTQ
SQGVVGTAQYLSPEQARGESVDMRSDLYSAGCVLYEMLTGRPPFTGDSAVAIAYQHVSEV
ATPPSTIVPGLPKMWDSICAKAMAKDRQNRYATASEFKNDLLTFMNGGVPMAAAFNPLTD
LTNMKARKQAEMDAATVPMAPATDAPTQAFNPVTGQFEAVPNPNGGVETKTRAEQRAKAV
QERKKKQIIIASVVGSIVVLLAVIGIFFALNGHKNTADLVSVPDFTDTSNISQARVEEQL
KALGLKLDARDDATSSQPKGTITKQNPQGGRKVAKGSTVSVWFSTGPQAVPVPDVSGKTQ
EEAKSILEAAGFKVGNVKTVDNATIAKDQVVNTDPAANSKQTKGTIITLYISSGMTKIPD
GLVGQAKDSVIAQLKQAGLTQITIESEYSDSVQSGAVTRIDPGSGSTVEMGTAVTIWVST
GKQQTSVPNVAGMNYADAKALLEGYGFQVNVSGPQDGTVASMSPNGGSKADNGSTITLTT
KAQPATDTGDNSNGNTTDNNQQQPQH
Download sequence
Identical sequences A0ZZD6
367928.BAD_0038 WP_011742591.1.36503 WP_011742591.1.64668 BdR37 gi|119025056|ref|YP_908901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]