SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025057|ref|YP_908902.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025057|ref|YP_908902.1|
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-75
Family Protein kinases, catalytic subunit 0.00000481
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025057|ref|YP_908902.1|
Sequence length 314
Comment serine-threonine protein kinase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MKLVEGQLIHRRYRLDSRLAQGGMGEVWKGYDIQLGRPVAIKALRGDLGVTQEAKLLRLR
AEAHNSANLAHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLYHEQNGPMDPIKLLPILI
QTARGLFVAHSHGVIHRDVKPANIMVSDSGEVKITDFGVSYSTNQEQITQDGMVVGTAQY
ISPEQAQGKHATPQSDIYSLGVVAYEGLCGHRPFTGATPVDIAAAHVNNPVPPLPDTVDV
QLREFVMSMLAKDPLDRPKDALVVSRTLSRIERRLLDQQTQLADTMVVSSGGRLPRRVVS
KPHISVSNDWKEQG
Download sequence
Identical sequences A0A076JJN3 A0A087DL16 A0ZZD7 A7A313 R5GZY9
gi|119025057|ref|YP_908902.1| 367928.BAD_0039 WP_003807258.1.16084 WP_003807258.1.23347 WP_003807258.1.24652 WP_003807258.1.31140 WP_003807258.1.31393 WP_003807258.1.3372 WP_003807258.1.36503 WP_003807258.1.38945 WP_003807258.1.41253 WP_003807258.1.43097 WP_003807258.1.47152 WP_003807258.1.51786 WP_003807258.1.54320 WP_003807258.1.55335 WP_003807258.1.55963 WP_003807258.1.5662 WP_003807258.1.6218 WP_003807258.1.64668 WP_003807258.1.68247 WP_003807258.1.74636 WP_003807258.1.76728 WP_003807258.1.81525 WP_003807258.1.90122 WP_003807258.1.92700 WP_003807258.1.95811 2004009182 BdR42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]