SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025061|ref|YP_908906.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025061|ref|YP_908906.1|
Domain Number 1 Region: 58-170
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.3e-26
Family FHA domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025061|ref|YP_908906.1|
Sequence length 171
Comment hypothetical protein BAD_0043 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MLTELTFAILKYGFLVLLWIFVACTVRSLYRDIETLSPRKSRAHRRKERAARKAVESPAP
VAAAAPSASAATNAKPTLLVIIDGPLAGSSVPLAGNTITLGRSASNTVVLDDEFVSSHHA
RVYTDPATGRWAIEDLGSTNGTVVNHQRLNAPMILGARVPVRIGATTFELR
Download sequence
Identical sequences A0A076JKF3 A0A087DL20 A0ZZE1 A7A317
2004019689 367928.BAD_0043 gi|119025061|ref|YP_908906.1| WP_003807267.1.16084 WP_003807267.1.23347 WP_003807267.1.24652 WP_003807267.1.31140 WP_003807267.1.31393 WP_003807267.1.3372 WP_003807267.1.36503 WP_003807267.1.38945 WP_003807267.1.41253 WP_003807267.1.43097 WP_003807267.1.47152 WP_003807267.1.51786 WP_003807267.1.54320 WP_003807267.1.55963 WP_003807267.1.5662 WP_003807267.1.6218 WP_003807267.1.64668 WP_003807267.1.68247 WP_003807267.1.74636 WP_003807267.1.81525 WP_003807267.1.90122 WP_003807267.1.92700 WP_003807267.1.95811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]