SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025095|ref|YP_908940.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025095|ref|YP_908940.1|
Domain Number 1 Region: 48-293
Classification Level Classification E-value
Superfamily PSTPO5379-like 6.93e-110
Family PSTPO5379-like 0.0000000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119025095|ref|YP_908940.1|
Sequence length 301
Comment hypothetical protein BAD_0077 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MNVRFCGIGFRSSSAVRSEKAGRRPTGKVSAMVDGMSDMGTTELGAASTPEQARAAFRDG
LVRPTCGIAQGYAQANLMILPKEQAFDFLLFAQRNHKPCPLLEVMEPGVTAPVTAPGADI
RTDVPLYRVWKRGELVAEVPDIREYWRSDLVTFVIGCSFTFEFPLMEAGVPVRHITAGRN
VPMYDTSIECRSAGAFHSTMVVSMRGIPSTQVADACRISGYYPSVHGAPVCVGDPSAIGI
DDIMHPDYGDAPVLEPGDVPVFWACGVTPQAAVMASKPEFAITHAPGHMFITSKRDLEYM
V
Download sequence
Identical sequences 367928.BAD_0077 gi|119025095|ref|YP_908940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]