SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025145|ref|YP_908990.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025145|ref|YP_908990.1|
Domain Number 1 Region: 546-737
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.18e-64
Family Polyphosphate kinase C-terminal domain 0.0000976
Further Details:      
 
Domain Number 2 Region: 147-353
Classification Level Classification E-value
Superfamily PHP14-like 1.22e-60
Family PPK middle domain-like 0.0004
Further Details:      
 
Domain Number 3 Region: 371-540
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 4.71e-57
Family Polyphosphate kinase C-terminal domain 0.00000706
Further Details:      
 
Domain Number 4 Region: 41-144
Classification Level Classification E-value
Superfamily PPK N-terminal domain-like 1.28e-34
Family PPK N-terminal domain-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025145|ref|YP_908990.1|
Sequence length 744
Comment polyphosphate kinase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MAQIFDAPSKAILRSQIAEHIAETDKNDKRELQAGEEPLPNDRFFDRELSWLKFNKRVLE
LAQDEDLPVIERASFAAIFANNLDEFFMVRVAGLKRRIDTGIAVTAASGLSPRQQLRAIS
EQAHRLQDEHAHYIIDHILPDLAKEQIVLLSWDKLTAAEQERLSRYYRQQVFPVLTPLAV
DPAHPFPYISGGSLNLAVLVENPASGKSHFARVKVPDNLNRLVPVDDLTEDENTNVRYGF
ITMENLIIAHLESLFPGMIIKEARSFRVTRNEDIDVEEDDAENLLNAMEKELLRRRFGPP
IRLEISDETSPFLSQLLADQLRVSADEVYRLPAPLDATVLFELGGIDRPDLKYRPFIPTT
NRQIAEVESSRAQDIFAAIRERDILLHHPYDSFSTSVQAFLAQAAADPKVLAIKQTLYRT
SSNSPIIDALIDAAHAGKQVLALVEIKARFDEDANIAWARKLERAGVHVVYGIVGLKTHC
KLSLVVRQEADGLRRYCHVGTGNYNPKTARIYTDLGLLTCDPVVGQDMTRLFNQLSGYAP
KSSFHRLLVAPRTVRSGLIQRIRREEDAARAGKEAWIKIKVNSIVDEKTIDALYRASQAG
VKIDIVERGICALKPGVPGLSENIRVRSILGRFLEHSRIYAFANSDGPQIGEGPAAGPEV
WIGSADLMHRNLDRRVEALVRIVAPEQIDELIKYVDLQMADSTASWHMQADGTYVRHCKD
EEGRPLVDSQEYLIKKHTRRPVRH
Download sequence
Identical sequences A0A0G9MGF6 A0ZZM5
2004011566 367928.BAD_0127 WP_011742670.1.23347 WP_011742670.1.24652 WP_011742670.1.36503 WP_011742670.1.64668 WP_011742670.1.74636 WP_011742670.1.90122 gi|119025145|ref|YP_908990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]