SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025156|ref|YP_909001.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025156|ref|YP_909001.1|
Domain Number 1 Region: 5-199
Classification Level Classification E-value
Superfamily Recombination protein RecR 2.48e-74
Family Recombination protein RecR 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025156|ref|YP_909001.1|
Sequence length 200
Comment recombination protein RecR [Bifidobacterium adolescentis ATCC 15703]
Sequence
MALAYDGAIQRLIDAFANLPGIGPKGAQRIAFYLLNAPDEESQALIDAITEVKEKVRFCD
ICGNVCETSPCPVCADPRRDHSVICVVEEPKDVMSIERTREYRGMYHVLGGVINPMANVQ
PSDLNIAKLIERLKDSEVKEVILALNPNVEGEATTSFLSQLLSQTDIKVTRLASGLPVGG
DLEYADEITLGRALAGRRAV
Download sequence
Identical sequences A0A087DLC1 A0A174CLX9 A0ZZN6
2004022722 gi|119025156|ref|YP_909001.1| 367928.BAD_0138 WP_011742676.1.16084 WP_011742676.1.36503 WP_011742676.1.38945 WP_011742676.1.43097 WP_011742676.1.6218 WP_011742676.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]