SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119025265|ref|YP_909110.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025265|ref|YP_909110.1|
Domain Number 1 Region: 4-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 8.76e-30
Family Ribosomal L11/L12e N-terminal domain 0.000076
Further Details:      
 
Domain Number 2 Region: 69-141
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 5.76e-26
Family Ribosomal protein L11, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025265|ref|YP_909110.1|
Sequence length 143
Comment 50S ribosomal protein L11 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MAPKKKVSALLKLQIQAGKANPAPPLGPALGSHGVNIMDFCKQYNAATQDKMGQVIPVEI
TVYEDRSFTFILKTPPAAALLKKAAGIQKGTENPLTHKVGSVTKAQVREIAEIKMADLSA
RDVEAGMKIIAGTARSMGITVTD
Download sequence
Identical sequences A0A076JGI7 A0A087CW54 A0A087DLM7 A0ZZZ5 A7A3T6 R5H4S0
gi|119025265|ref|YP_909110.1| WP_003807772.1.10596 WP_003807772.1.14720 WP_003807772.1.16084 WP_003807772.1.23347 WP_003807772.1.24652 WP_003807772.1.31140 WP_003807772.1.31393 WP_003807772.1.3372 WP_003807772.1.36503 WP_003807772.1.38945 WP_003807772.1.41253 WP_003807772.1.43097 WP_003807772.1.47152 WP_003807772.1.51786 WP_003807772.1.54320 WP_003807772.1.55335 WP_003807772.1.55963 WP_003807772.1.5662 WP_003807772.1.6218 WP_003807772.1.64668 WP_003807772.1.68247 WP_003807772.1.74636 WP_003807772.1.76728 WP_003807772.1.81525 WP_003807772.1.90122 WP_003807772.1.92700 WP_003807772.1.95811 WP_003807772.1.98010 367928.BAD_0247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]