SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025293|ref|YP_909138.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025293|ref|YP_909138.1|
Domain Number 1 Region: 3-235
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 5.37e-48
Family Purine and uridine phosphorylases 0.0000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025293|ref|YP_909138.1|
Sequence length 235
Comment 5'-methylthioadenosine nucleosidase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTAIAIIGAMDEEVANIATALSNVTVTEEAGVKVTRGTLETNKGTAVNVAATVGGMGTVN
IAATTQHLIDADQPDAVIFSGIAGNLNTNLHINDVVLGGTLRYLDTDMRLVGQFKPGTAD
RPIEEYHSDDRLLELADQALNDLNIHHIVGIIATGNYFVDDPQKVEQVIRETGADAVEME
GAAVAHVAARNDVPALVIRALSDNADTDYEDFKTFDISEYADTAAKLTVNIAKRM
Download sequence
Identical sequences A0A076JL46 A0A087DLQ5 A1A023 A7A3W7 R5GZX2
gi|119025293|ref|YP_909138.1| 367928.BAD_0275 WP_003807845.1.16084 WP_003807845.1.23347 WP_003807845.1.24652 WP_003807845.1.31140 WP_003807845.1.31393 WP_003807845.1.3372 WP_003807845.1.36503 WP_003807845.1.38945 WP_003807845.1.43097 WP_003807845.1.47152 WP_003807845.1.51786 WP_003807845.1.54320 WP_003807845.1.55963 WP_003807845.1.6218 WP_003807845.1.64668 WP_003807845.1.68247 WP_003807845.1.74636 WP_003807845.1.76728 WP_003807845.1.90122 WP_003807845.1.92700 WP_003807845.1.95811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]