SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025304|ref|YP_909149.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025304|ref|YP_909149.1|
Domain Number 1 Region: 24-119
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000604
Family FHA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025304|ref|YP_909149.1|
Sequence length 501
Comment hypothetical protein BAD_0286 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MSEDRRMTRQWTVKVDGNNVKTLHDGESVEIGRKPLRPLSDDGFARLDIMDPGKSMSKRH
AVLSVDKQGNCSVRDLHSTNGSFVVTNNGQLMRLPAGEDIKLPIDSMTLQFGDVRLTLES
AFEHDDEDDDATSGVSDDTSQPVSNLFEYAVSDEAPQEPDAADMSVDDILNLRAGEPTTF
FHARNVTDRADALHQAERQTFTPEHADKPELEDAFPSVSLVQETVVAADKPRDLFADAAA
QAEAEAEIEADAADSADAAATDAEVAAVSTETAAQPLEASHDGNKNNLIPVDKLFSARPS
TPIAVALPDRNDTGDNTGNVDKADNAADASAQEQTQSAEQSQMAEQPTSETAEQQPAEQQ
SKPMHATQPQTEQPGTVTAEDDDERFRPQNSQSQPAPDETAAFKPIFEPGSVFDRVSKGG
LAKQEQTIEVDGLTSDDAKRTDDFTVQFQMARHPELLPFLAMNPSLYDDLYAWLGALGNQ
DIDAALAHNPGYEEYRKAVGK
Download sequence
Identical sequences A1A034
gi|119025304|ref|YP_909149.1| 367928.BAD_0286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]