SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025437|ref|YP_909282.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025437|ref|YP_909282.1|
Domain Number 1 Region: 61-128,193-468
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 1.6e-31
Family Dihydroorotase 0.08
Further Details:      
 
Domain Number 2 Region: 27-61,464-510
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000000198
Family SAH/MTA deaminase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025437|ref|YP_909282.1|
Sequence length 515
Comment hypothetical protein BAD_0419 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MAGNEVILLNRGCMGEPYVIENVCFVGSDESVDITIEQGRIADVRSSEKSVAKASKTWII
PGLWDCHTHFTQWSYTLGRLDLIDARSADEAMSLLREHLEERRESGTLDPDQYVVGMRFR
HSLWADDAQPTLAAIDAVSGDQPVALSSADMHCGWVNSAAARKLGVHVGESGLVGELEWF
DAYCKLDKGPGAADELMRLLRNAEQDAAGKGVVGVRDYEMAENIDTWIDRFKQGLDGLRI
EAGVYPERLQQAIDDGWHTGDELPGSHGLGHVGAMKMISDGSLNTRSAYCSTPYSGITPE
TYGTLSYTPEQIESYMRLATEHGFDIACHAIGDEANTIVLDCAERTHAHGSIEHAQMLKE
RDIPRLAQLGLAASIQPQHAMDDRDVITRFWGNPAGIPYAFNSLHKSGTKLLMGSDAPVA
PLDPWLAISAAVFGTESSDREPFQSEQCLDFETALASSTALGRTTLQAGDAADLVLLDCD
PSELESPEAMRAMPDHVLATMLAGCWTYQSHVSRL
Download sequence
Identical sequences A0A173YRC8 A1A0G7
gi|119025437|ref|YP_909282.1| 367928.BAD_0419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]