SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025459|ref|YP_909304.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025459|ref|YP_909304.1|
Domain Number 1 Region: 13-358
Classification Level Classification E-value
Superfamily Release factor 4.71e-120
Family Release factor 0.0000000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025459|ref|YP_909304.1|
Sequence length 362
Comment peptide chain release factor 1 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MADEQFPAAVTALEEYHNIEQQMAEPEVASNPDKMRKLGRRHAELGAIVSAYTAYKQVKD
DLEAAREMASEDPDFAEEAKRLEGELPAAEEKLRTALIPRDPDDARDTIMEIKAGTGGEE
AALFAGDLLRMYMRYAEKRGWSVTVQSENTTELGGVKDVQLAIRAKGTPAPEDGVWASLK
YEGGVHRVQRIPVTESQGRIQTSAAGVIVFPEADEDDDEIEIDPKDLKIDIFMSSGPGGQ
SVNTTYSAVRMTHIPTGITVNMQDEKSQIQNRAAALRVLKSRLLAMKHEQEAAEAADMRH
SQVRSLDRSERIRTYNFPENRIVDHRTNYKAYNLDAVLDGDLQAVIDSDIQADEADRLAN
QK
Download sequence
Identical sequences A0A076JKW7 A1A0I9 A7A4G1 R5GVR8
367928.BAD_0441 WP_003808375.1.23347 WP_003808375.1.31140 WP_003808375.1.31393 WP_003808375.1.3372 WP_003808375.1.36503 WP_003808375.1.41253 WP_003808375.1.47152 WP_003808375.1.51786 WP_003808375.1.54320 WP_003808375.1.55335 WP_003808375.1.55963 WP_003808375.1.5662 WP_003808375.1.6218 WP_003808375.1.64668 WP_003808375.1.68247 WP_003808375.1.74636 WP_003808375.1.76728 WP_003808375.1.81525 WP_003808375.1.95811 gi|119025459|ref|YP_909304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]