SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025481|ref|YP_909326.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025481|ref|YP_909326.1|
Domain Number 1 Region: 29-366
Classification Level Classification E-value
Superfamily Release factor 1.83e-120
Family Release factor 0.0000000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025481|ref|YP_909326.1|
Sequence length 376
Comment peptide chain release factor 2 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MAEFDYSEAISEARAKYESISKALDVDRLTAEAKDLEVKAAEPGLWDDPENAQKVTSKLS
AVQSQLKRLASADQRIEDVETLVELGQEEEDADTLAEAKAEVESIQKDLDDMEIQTLLDG
EYDERSAVVTIRSGAGGVDAADFAQMLLRMYLRWAERNGYKAKVMDTSYAEEAGIKSATF
QVDAPYAYGRLSVEGGTHRLVRISPFDNQGRRQTSFAAVEVVPLVEATDHIDVPDSEIRV
DTYCSSGPGGQGVNTTYSAVRITHIPTGIVVTMQDERSQIQNRAAAMAVLQSRLLVLRHE
EEAKKKKELAGDIKASWGDQMRSYVLHPYQMVKDLRTGYETSQTQAVFDGDIDEFIEAGI
RWRHEQRRAAAEEQEA
Download sequence
Identical sequences A0A076JLN0 A0A087DM93 A1A0L1 A7A4I7 R5H0T2
WP_003808420.1.16084 WP_003808420.1.23347 WP_003808420.1.24652 WP_003808420.1.31140 WP_003808420.1.31393 WP_003808420.1.36503 WP_003808420.1.38945 WP_003808420.1.41253 WP_003808420.1.43097 WP_003808420.1.47152 WP_003808420.1.51786 WP_003808420.1.54320 WP_003808420.1.55335 WP_003808420.1.55963 WP_003808420.1.5662 WP_003808420.1.6218 WP_003808420.1.64668 WP_003808420.1.68247 WP_003808420.1.74636 WP_003808420.1.76728 WP_003808420.1.81525 WP_003808420.1.90122 WP_003808420.1.92700 WP_003808420.1.95811 gi|119025481|ref|YP_909326.1| 367928.BAD_0463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]