SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025591|ref|YP_909436.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025591|ref|YP_909436.1|
Domain Number 1 Region: 498-811
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.52e-80
Family Extended AAA-ATPase domain 0.00000000673
Further Details:      
 
Domain Number 2 Region: 175-473
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.26e-75
Family Extended AAA-ATPase domain 0.0000000333
Further Details:      
 
Domain Number 3 Region: 3-151
Classification Level Classification E-value
Superfamily Double Clp-N motif 2.45e-32
Family Double Clp-N motif 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025591|ref|YP_909436.1|
Sequence length 864
Comment ATP-dependent Clp protease ATP-binding subunit [Bifidobacterium adolescentis ATCC 15703]
Sequence
MFERFTDRARRVIVLAQEEARTLQHNYIGTEHLLLGLIREGEGVAAKALASKGVTLDDTR
KQVEEMIGKGNASPNGHIPFTPHARQVLELSLREALQLGHSYIGTEHILLGLIHEGEGVG
TQVLIKMDVNLGELRSATIDLIRGNSSDGKNDSKGELANAGGVQDRRNQTGSAILDQFGR
NLTAEAAAGKLDPVIGRSNEIERVMVVLSRRTKNNPVLIGEPGVGKTAVVEGLAQKINAG
DVPETLKGKQVYSLDLGSMVAGSRYRGDFEERLKKVLKEIKTRGDIVLFIDEIHTIVGAG
SADGALGASDMLKPMLARGELQTIGATTTDEYRKYIEKDAALERRFQPIQVHEPTIAETI
EILKGLRERYENHHHVTITDGALQAAAELSSRYIQDRHLPDKAIDLIDEAGARLRIRRLT
APPELKELDAKAAKLAEEKDQAIKDQDFEKAAELRDKQEKIESERKEKESAWREGESDVK
MVVDEDVIAEVISQTTGIPVFKLTQAESKKLMGMESELHKRIIGQDEAVSALSRSIRRAR
VGLKDPKRPAGSFIFAGPTGVGKTELAKALAEFLFDDEDALIRVDMSEFSEKYAASRLFG
APPGYVGYEEGGELTEKVRRKPFSVVLFDEIEKAHPDIFNTLLQVLDDGHLTDGQGRKVD
FKNTIIILTTNLGTRDIAKAANTGFNLGTNTESSYQRMKEQVSAELKQQFRPEFLNRLDD
IIVFKQLTEPQVRQIVDLDVKQLNDRLFDRHMSLELTDAAKDLLAQKGFDPLLGARPLRR
VIQRDIEDAISEKILMGDLEDGQRVRVDAEGEGILGEFTFTGEAFEEPNQKDNPAEATET
ATETDAATEPTASTEPADSAQSQN
Download sequence
Identical sequences A1A0X1
367928.BAD_0573 WP_011743014.1.36503 WP_011743014.1.64668 gi|119025591|ref|YP_909436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]