SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025609|ref|YP_909454.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025609|ref|YP_909454.1|
Domain Number 1 Region: 34-223
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.67e-17
Family COMT-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119025609|ref|YP_909454.1|
Sequence length 223
Comment methyltransferase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MDRTSYTNLAKSWEYVEDHAFSRQSAELNAIRTAAEEAGIPQGSAAQAELLRMLVRMLDA
SSVIAIGTGSVVETMQLINGLDNAGQLTAVDSSTQGIALIRKLFNRLSDDTETTLRAVNA
SAGVFLPRLNAENYDLIVVAGDSENYAAAFAQAPRLLKPHAAIVFTDVLAFDSATSAGGV
LNPANRDAKSIAMRELLETVESDERFVTALTPTGTGLLVAVKK
Download sequence
Identical sequences A0A1E7XYX2 A1A0Y9
367928.BAD_0591 gi|119025609|ref|YP_909454.1| WP_011743028.1.23347 WP_011743028.1.36503 WP_011743028.1.55335 WP_011743028.1.6218 WP_011743028.1.64668 WP_011743028.1.92700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]