SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025736|ref|YP_909581.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025736|ref|YP_909581.1|
Domain Number 1 Region: 82-263
Classification Level Classification E-value
Superfamily alpha/beta knot 9.94e-37
Family YggJ C-terminal domain-like 0.0006
Further Details:      
 
Domain Number 2 Region: 20-75
Classification Level Classification E-value
Superfamily PUA domain-like 0.000000157
Family YggJ N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119025736|ref|YP_909581.1|
Sequence length 265
Comment 16S ribosomal RNA methyltransferase RsmE [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTDALFLLDTDHDDVPVNSDELNAGWRLTLPSSVRRHAIQAMRLKDGDELQLSDGRGLRI
HAVLRDVQQGIAEVLRFGKEPQPVTRLALVQALAKTGHDEQAIDMATQIGVDQVIPWQAD
RSIAKWKAGRTDKKWRQVLESATEQSRRSWTPQLDDCVTSKQVVAICKRACVHGDMVIVL
HQDATKTWEQLETGIAKLSDTCLKDGRPRTIYVLVGPEGGISDAEVEAFTKAGAEVCVLG
SNILRASTAGPVALSLLARALGRFV
Download sequence
Identical sequences A1A1B6
WP_011743130.1.36503 WP_011743130.1.64668 gi|119025736|ref|YP_909581.1| 367928.BAD_0718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]