SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025771|ref|YP_909616.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025771|ref|YP_909616.1|
Domain Number 1 Region: 6-57,85-287
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.66e-62
Family tRNA(1-methyladenosine) methyltransferase-like 0.00000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119025771|ref|YP_909616.1|
Sequence length 351
Comment hypothetical protein BAD_0753 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MRRGPLAAGEKVQFTDRRSNKITDQLVPGGVTQTSHGIILHDDVIGQTEGSVVVTVSAKR
EAQVNQTHPERDANKPWKGTRAIGGWEFAVMRPRLADYVLSMPRGAQIMYPKDIAQVIQL
GDIRSGMNVLESGAGSGAMSINLLDAVGEGGSLTTIEMRSEFARVAEANATVYFGKRPAW
WDLRTGDFDSVAAGLPEHSFDRIMLDMLDPWNRLEQAYRVIAPGGVLVAYVTTTTQLSRL
AEALREVGCWTEPDMQETLERNWKAQGLAIRPDHQMIGHTGFLMVSRAMAPGFQALRKRD
RATKDTTTDIDSLTPEERAEQLEDLELRDISDRKLRKVLRDLDAQVEAIKE
Download sequence
Identical sequences A1A1F1
gi|119025771|ref|YP_909616.1| 367928.BAD_0753 WP_011743154.1.36503 WP_011743154.1.64668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]