SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025779|ref|YP_909624.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025779|ref|YP_909624.1|
Domain Number 1 Region: 39-384
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 5.11e-81
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.00000893
Further Details:      
 
Domain Number 2 Region: 412-465
Classification Level Classification E-value
Superfamily Composite domain of metallo-dependent hydrolases 0.000000000166
Family Hydantoinase (dihydropyrimidinase) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119025779|ref|YP_909624.1|
Sequence length 472
Comment dihydroorotase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTLTLHDIKVWNTGEVIDLVVPSDTDASVDASAMTIAPGFEDPHVHFRDPGQTYKESMIS
GCAAAASGGYTNVLIMPNTVPAMDGVKVEAGQPGASEVLDAEYDTVIDYLQHYEAAHGVK
LPVRYDLCVCASKGRAGHEATEVADWIGYLPEHGDEHKDAYQLAHPVTAISDDGSAVTPS
ILEQVFENVKESGLYLIEHCEHHDTGAVNDGPVSRKLGVPGIPEDTELKIVERDIDMSRK
TGVHVHFQHVSTAISFDAIRKAKAEGLPITCETAPHYIALNDEALLKYGTLAKMNPPLRS
EADRQATIAAVADGTVDLLATDHAPHTMEEKELGFLDAPNGIIGLECAYGVCHKILVDGG
FISDERLIELMSTGPAELMGHDKTDITAVLDDYADAVPGDDDTKRVLDLGRVPESDQVDL
VVLNTGEEWTVDPEKFHSSARNTPFGGWQVTGRPLATIIGSKLAFSRIDKED
Download sequence
Identical sequences A0A087DSJ7 A0A0C2V811 A1A1F9
367928.BAD_0761 gi|119025779|ref|YP_909624.1| WP_011743301.1.16084 WP_011743301.1.36503 WP_011743301.1.38945 WP_011743301.1.55963 WP_011743301.1.64668 WP_011743301.1.68247 WP_011743301.1.81525 WP_011743301.1.92700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]