SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025791|ref|YP_909636.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025791|ref|YP_909636.1|
Domain Number 1 Region: 71-138
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 0.00000157
Family Glucose permease-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025791|ref|YP_909636.1|
Sequence length 207
Comment hypothetical protein BAD_0773 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MNKWEYRRRVRHNKMSDDIDKRNRHRCAAAMAVCVLANIAFTICCAQPTASAYAQSADDV
AHEVAQAACRTSMQWPLEHAQVIGEYDAPAKQWLPGHRGLDLRARPQDAIIAPADGVVAF
SGKVAGKSVVTLRHGAETGSLTSTFEPAVTTRPVGAVIAKGERFARVEGGSEHCADGCLH
WGLKSGGRDYADPSGRVRSMRVELKPL
Download sequence
Identical sequences A0A076JNL3 A0A087DSI6 A1A1H1 R5H6U6
367928.BAD_0773 WP_011743162.1.16084 WP_011743162.1.3372 WP_011743162.1.36503 WP_011743162.1.38945 WP_011743162.1.51786 WP_011743162.1.54320 WP_011743162.1.5662 WP_011743162.1.6218 WP_011743162.1.64668 gi|119025791|ref|YP_909636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]