SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025802|ref|YP_909647.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025802|ref|YP_909647.1|
Domain Number 1 Region: 3-183
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 2.75e-65
Family Ribosome recycling factor, RRF 0.00000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025802|ref|YP_909647.1|
Sequence length 184
Comment ribosome recycling factor [Bifidobacterium adolescentis ATCC 15703]
Sequence
MATIVDQAKAQMAKSVESTKENFSGIRTGRANPALLNGITVDYYGAPTPLKAVATIGVPE
PRTLAVTPFDASQANAVEKALRDSDLGASPRRDGNVIRLTMPELTEERRKEYVKIAKGKA
EDGKVAVRNIRRKAKESLDKAIKDGDMGEDEGDRLLKELDKVTKQTTDELDALLETKQKE
IMEV
Download sequence
Identical sequences A0A076JI02 A0A087DSH5 A1A1I2 A7A5U1 R5GTZ9
WP_003809323.1.16084 WP_003809323.1.23347 WP_003809323.1.24652 WP_003809323.1.31140 WP_003809323.1.31393 WP_003809323.1.3372 WP_003809323.1.36503 WP_003809323.1.38945 WP_003809323.1.41253 WP_003809323.1.47152 WP_003809323.1.51786 WP_003809323.1.54320 WP_003809323.1.55335 WP_003809323.1.55963 WP_003809323.1.5662 WP_003809323.1.6218 WP_003809323.1.64668 WP_003809323.1.76728 WP_003809323.1.81525 WP_003809323.1.90122 WP_003809323.1.92700 gi|119025802|ref|YP_909647.1| 367928.BAD_0784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]