SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025844|ref|YP_909689.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025844|ref|YP_909689.1|
Domain Number 1 Region: 13-89,116-250
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.77e-29
Family APH phosphotransferases 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025844|ref|YP_909689.1|
Sequence length 263
Comment hypothetical protein BAD_0826 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MGKYRKSRAFSPEGFFECEGRGLKWLGEAQSQGGPRVVDVYDWGKDYLDIERVNACGPTI
QAARDFGVALAHMHDAGAEHFGSAPTGYDGTCYFGPLQDPVPMNAGAWDDVATYLADGRL
RPMVRLGMKRRELTDYDMELTEAVIDALPDILGKAANDKPARVHGDLWSGNVMWTADSGD
VEAVLIDPAAHGGHREEDLAMLDLFGMSYLTDILEGYQSAHPLKAGWQDRITLWQLYPIA
GHCVFFGGGYVSRYRAMCRSLLK
Download sequence
Identical sequences A1A1M4
WP_011743197.1.36503 WP_011743197.1.64668 367928.BAD_0826 gi|119025844|ref|YP_909689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]