SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025845|ref|YP_909690.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025845|ref|YP_909690.1|
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.81e-35
Family Chaperone J-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 260-346
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 4.45e-19
Family HSP40/DnaJ peptide-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 131-211
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.00000000000000209
Family DnaJ/Hsp40 cysteine-rich domain 0.00026
Further Details:      
 
Domain Number 4 Region: 111-166,214-268
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000000012
Family HSP40/DnaJ peptide-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119025845|ref|YP_909690.1|
Sequence length 383
Comment chaperone protein DnaJ [Bifidobacterium adolescentis ATCC 15703]
Sequence
MTDYYEVLGVDRSASDDEIKKAYRKMSRKYHPDIAGPEFEDKFKEVNNAYDVLSDPKKRQ
MYDAGVDPNDPNAGGMHGGGFGGGFGDMGDIFSMFTGGGFGGTGGGPTPRTQPGRDALVS
ATIDLKTAVFGDTTHVKVNTFGLCQECGGTGCQNGTQPTQCPDCHGQGYAQRVVRTMLGQ
MMTTAPCERCEGHGTVIEKPCPSCLGHGRVRVTRNVGVAVPAGVANNTRLRLANQGEVGE
NGGVAGDLYVDIRIKPDDMFTRDDDDLHCWIKVPMSWAVLGHEVEIDTFDGRQTLDIPAG
SQPDDTVTLKNLGVTHLDDKNERGDLVAHVVVEIPKKLSDDERELIERFGEMHDTDAQHV
AVKSRPSSGAKKGFFSKLKDALR
Download sequence
Identical sequences A0A087DSC8 A0A1X2ZXJ2 A1A1M5
367928.BAD_0827 BdR44 WP_011743198.1.16084 WP_011743198.1.24652 WP_011743198.1.3372 WP_011743198.1.36503 WP_011743198.1.38945 WP_011743198.1.55335 WP_011743198.1.55963 WP_011743198.1.6218 WP_011743198.1.64668 WP_011743198.1.68247 WP_011743198.1.90122 gi|119025845|ref|YP_909690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]