SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025852|ref|YP_909697.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025852|ref|YP_909697.1|
Domain Number 1 Region: 5-259
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 2.09e-80
Family Triosephosphate isomerase (TIM) 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119025852|ref|YP_909697.1|
Sequence length 264
Comment triosephosphate isomerase [Bifidobacterium adolescentis ATCC 15703]
Sequence
MGPKRIPLVAGNWKMNFDHLEATYFVQQLAWNLRAIHFDYKRCEIALMPSFTSLRSVQVA
VESDNLKIRYGAQAVSVTSQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESYEERRKGIELDFAVGQVHDVTRDLSDEEAAKLIVAYEPVWA
IGTGMVATPQSAQDAARAIRNDLSDTFGTRVGETVRILYGGSVSSKNAVELINEPDVDGF
LIGGSALKVDELTRICKLTLETTA
Download sequence
Identical sequences A0A087DSC1 A0A173WEJ4 A1A1N2
WP_011743203.1.16084 WP_011743203.1.24652 WP_011743203.1.31393 WP_011743203.1.3372 WP_011743203.1.36503 WP_011743203.1.38945 WP_011743203.1.41253 WP_011743203.1.55335 WP_011743203.1.55963 WP_011743203.1.6218 WP_011743203.1.64668 WP_011743203.1.76728 WP_011743203.1.90122 WP_011743203.1.92700 gi|119025852|ref|YP_909697.1| 367928.BAD_0834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]