SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|119025879|ref|YP_909724.1| from Bifidobacterium adolescentis ATCC 15703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119025879|ref|YP_909724.1|
Domain Number 1 Region: 218-335
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 2.55e-17
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.025
Further Details:      
 
Weak hits

Sequence:  gi|119025879|ref|YP_909724.1|
Domain Number - Region: 22-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00743
Family Extended AAA-ATPase domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|119025879|ref|YP_909724.1|
Sequence length 339
Comment hypothetical protein BAD_0861 [Bifidobacterium adolescentis ATCC 15703]
Sequence
MPVLSTDTARLNGMPKPSAATTPFHLVYGGDSYLNDQTVRDLKHEAQRRYPDAETIELDA
ANADHYTFDEAVSPSLLADRAIVIVTNLQNADEKLGDAMVSYCRQACKEPADACIVICQH
EGGVKGKRLVEQLTKAGAYKDAVADLKKPEAKLNFVMQCFERRKRRVEPMAAQQLVAVLG
DRTGELAAMVGQLCFDFDDNPMTLDRVNQYLTSNPQVDGFRVADLALSGRTADAIIAMRS
SVEQGTAPIALIGALAMKLRTMAKASAVRAGTISTAEAKTNPWVLKNATRQLSGWTSSGM
SACIQMLAWADEQSKTNGSDPVYALERSIELISRKGRAA
Download sequence
Identical sequences A0A173YNC2 A1A1Q9
2004018520 gi|119025879|ref|YP_909724.1| WP_011743226.1.36503 WP_011743226.1.64668 WP_011743226.1.95811 367928.BAD_0861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]